PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AS_A79A68739.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 273aa    MW: 29313.5 Da    PI: 10.3658
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AS_A79A68739.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.63.3e-192569247
                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                           g+W++eEd llv +v+q+G ++W+ I++ ++ gRt+k+c++rw + 
  Traes_4AS_A79A68739.1 25 GSWSPEEDALLVALVRQHGARRWSVISASVP-GRTGKSCRLRWCNQ 69
                           89*****************************.***********985 PP

2Myb_DNA-binding50.54.7e-1678120347
                            SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            ++T +Ed l++ a +++G++ W+ Iar ++ gRt++++k++w++ 
  Traes_4AS_A79A68739.1  78 PFTVQEDALIIAAQARYGNK-WADIARLLP-GRTDNSVKNHWNSN 120
                            89******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.5521974IPR017930Myb domain
SuperFamilySSF466896.47E-3022117IPR009057Homeodomain-like
SMARTSM007179.2E-172372IPR001005SANT/Myb domain
PfamPF002493.2E-182469IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-242577IPR009057Homeodomain-like
CDDcd001672.79E-162668No hitNo description
SMARTSM007171.6E-1475123IPR001005SANT/Myb domain
PROSITE profilePS5129419.93575125IPR017930Myb domain
CDDcd001673.44E-1278121No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2078123IPR009057Homeodomain-like
PfamPF002496.9E-1478120IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MIPAVACVGY DRTDAMEVPS PIKTGSWSPE EDALLVALVR QHGARRWSVI SASVPGRTGK  60
SCRLRWCNQL SPAVQHRPFT VQEDALIIAA QARYGNKWAD IARLLPGRTD NSVKNHWNSN  120
LRRCQRRAKA MAAATAARVA ASSSSSGSAV RAKMQQEEQV MVMNRSPPAV VHGAVTAVID  180
DPMPMLSLTL SLGLPQMAAD KASEEAKAKA KEKTPPPVGV GGNDVRLMAA IRQVVREEVE  240
RQAGQLLYSV VMATTAARVD GASSSDHPTN GHH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-36251235103MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-351912354157MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-351912354157MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-36251235103C-Myb DNA-Binding Domain
1msf_C6e-36251235103C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3741111e-137AK374111.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3054K02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002489094.12e-63hypothetical protein SORBIDRAFT_0088s002210
TrEMBLW5DZ400.0W5DZ40_WHEAT; Uncharacterized protein
STRINGSi022959m2e-71(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP135442731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.12e-48myb domain protein 70
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]